PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G26930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 254aa    MW: 27455.5 Da    PI: 6.1726
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G26930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.12.9e-11127168445
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                       kr +r   NR +A+rsR RK+++i eLe+ v +L++e + L
  LPERR01G26930.1 127 PKRVKRILANRQSAQRSRVRKLQYISELERSVTTLQNEVSVL 168
                      5999*********************************97766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.2E-14124188IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.795126178IPR004827Basic-leucine zipper domain
PfamPF001701.0E-9128173IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.4E-12128182No hitNo description
SuperFamilySSF579596.05E-12128182No hitNo description
CDDcd147038.30E-25129180No hitNo description
PROSITE patternPS000360131146IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MAQLPPKIPV APGQQHWGAD AAWAEEFSEF AAARRGAHRR SLSDSVAFVE VAPAGCGAGE  60
FDRLDDDQLM SMFPDEGGSA PVSDNGGSDS DGAARGEDGQ PASDDAAAGE QPPEQAAASP  120
TELIRDPKRV KRILANRQSA QRSRVRKLQY ISELERSVTT LQNEVSVLSP RVAFLDQQRT  180
ILTVGNSHLK QRIAALAQDK IFKDAHQEAL RKEIERLRQV YQQQSVKLSG GLAADHAHAH  240
GGPPPVRAEK ELMS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1085530.0AK108553.1 Oryza sativa Japonica Group cDNA clone:002-144-E08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634100.11e-136PREDICTED: basic leucine zipper 6
SwissprotQ5JMK61e-138BZP06_ORYSJ; Basic leucine zipper 6
TrEMBLA0A0D9V5T20.0A0A0D9V5T2_9ORYZ; Uncharacterized protein
STRINGBGIOSGA004481-PA1e-135(Oryza sativa Indica Group)
STRINGLOC_Os01g55150.11e-135(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.21e-64bZIP family protein